GCPred


GCPred is a webserver for the prediction of adenylyl cyclase functional centers (GCCs) from amino acid sequence. GCC is a novel class of functional centers typically consisting of short 14 amino acids and is found in complex multi-domain proteins. They are different from canonical GC domains hence GCPred is not valid for the prediction of such domains as well as transmembrane regions.

Instructions:
The software takes a single or multiple amino acid sequence and returns predicted GCCs each accompanied by GCC values 0-1, where 1 is closest to the mean of experimentally validated GCCs.

Please enter single letter amino acid codes in FASTA format and select if co-factor binding (Mg2+/Mn2+) is required. The amino acid implicated in co-factor binding is found at 0-3 positions downstream of the GCC.

Requirement for Mg2+/Mn2+ co-factor

For example
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=1 SV=4
MRVHRFCVIVIFLTELLCFFYSSESQTTSRCHPHDLEALRDFIAHLEPKP DGWINSSSSTDCCNWTGITCNSNNTGRVIRLELGNKKLSGKLSESLGKLD EIRVLNLSRNFIKDSIPLSIFNLKNLQTLDLSSNDLSGGIPTSINLPALQ SFDLSSNKFNGSLPSHICHNSTQIRVVKLAVNYFAGNFTSGFGKCVLLEH LCLGMNDLTGNIPEDLFHLKRLNLLGIQENRLSGSLSREIRNLSSLVRLD VSWNLFSGEIPDVFDELPQLKFFLGQTNGFIGGIPKSLANSPSLNLLNLR NNSLSGRLMLNCTAMIALNSLDLGTNRFNGRLPENLPDCKRLKNVNLARN TFHGQVPESFKNFESLSYFSLSNSSLANISSALGILQHCKNLTTLVLTLN FHGEALPDDSSLHFEKLKVLVVANCRLTGSMPRWLSSSNELQLLDLSWNR LTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNEPS PDFPFFMKRNESARALQYNQIFGFPPTIELGHNNLSGPIWEEFGNLKKLH VFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKF SVAYNNLSGVIPSGGQFQTFPNSSFESNHLCGEHRFPCSEGTESALIKRS RRSRGGDIGMAIGIAFGSVFLLTLLSLIVLRARRRSGEVDPEIEESESMN RKELGEIGSKLVVLFQSNDKELSYDDLLDSTNSFDQANIIGCGGFGMVYK ATLPDGKKVAIKKLSGDCGQIEREFEAEVETLSRAQHPNLVLLRGFCFYK NDRLLIYSYMENGSLDYWLHERNDGPALLKWKTRLRIAQGAAKGLLYLHE GCDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTL GYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISW VVKMKHESRASEVFDPLIYSKENDKEMFRVLEIACLCLSENPKQRPTTQQ LVSWLDDV



If you find GCPred useful for your work, please cite:
Xu N, Fu D, Li S, Wang Y & Wong A (2018). Bioinformatics, DOI: 10.1093/bioinformatics/bty067

GCPred was built based on previous work published in:
Wong A, Tian X, Gehring C & Marondedze C (2018). Comput Struct Biotechnol J, 16 (2018), pp. 70-76
Wheeler J, Wong A, Marondedze C, Arnoud G, Kwezi L et al. (2017). Plant J 91(4), 590-600
Wong A, Gehring C & Irving HR (2015). Front Bioeng Biotechnol 82, 1-8
Wong A & Gehring C (2013). Cell Commun Signal, 11(1), 48
Wong A & Gehring C (2013). Methods Mol Biol, 1016, 195-205, Humana Press
Ludidi N & Gehring C (2003). J Biol Chem 278(8), 6490-6494

This tool is still under development and the GCC values will be revised as new experimental data becomes available. Additional features and improvements are forthcoming.

We also provide a trial service for the prediction of adenylyl cyclase (AC) functional centers. Please click here to access the ACPred webtool.

Please contact us at alwong@kean.edu if you have any questions or comments.